DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and cela2a

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_017945752.1 Gene:cela2a / 594883 XenbaseID:XB-GENE-970278 Length:269 Species:Xenopus tropicalis


Alignment Length:287 Identity:89/287 - (31%)
Similarity:130/287 - (45%) Gaps:42/287 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFVVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGS 65
            |...:||||.||.|....:|...||           ..|:.||:|.....:|:||.|.: ...|.
 Frog     1 MTPLLVLVLCLAGAYCCGVPTYQPV-----------VSRVVNGEDVAPHSWPWQVSLQY-LYYGY 53

  Fly    66 WW--CGGSIIGNEWVLTAAHCTDGAASVTIYYGA-TVRTSPEFTQVVSSSKFRQHESYLALTIRN 127
            |:  ||||:|.:.||||||||.....:..:..|. .:|......::::.||...|..:...::.|
 Frog    54 WYHTCGGSLISSNWVLTAAHCISSYNTYRVQLGKHNLRYIEPGQKIINVSKLINHPRWDPNSLGN 118

  Fly   128 --DISLIQ-TSSVSFSATVNKISLP----AVSNSYSTYEGKTAVASGWG--LTSDQATAVSRDLQ 183
              |||||: ..||.||.||....||    .:.:.|..|      .:|||  .|......:   ||
 Frog   119 GFDISLIKLEESVDFSDTVQPACLPPAGYILPHQYGCY------VTGWGNIRTGGPEPDI---LQ 174

  Fly   184 YVDLTIISNSKCQ--ETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLALDGV-----LIGATSFG 241
            ...|.::..:.|.  :.:|..:.|: ::|.......|:|.|||||||.....     :.|..|||
 Frog   175 QGLLLVVDYATCSQWDWWGDGVRTN-MICAGGDGITSSCNGDSGGPLNCRNANGTWEVHGVVSFG 238

  Fly   242 SADGCE-SGAPAAFTRITYYRDWIKET 267
            ||.||. ...|:.|:|::.:..||..|
 Frog   239 SAAGCNYPKKPSVFSRVSEFNSWISTT 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 75/244 (31%)
Tryp_SPc 40..267 CDD:238113 76/246 (31%)
cela2aXP_017945752.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.