DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG18754

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:277 Identity:65/277 - (23%)
Similarity:109/277 - (39%) Gaps:56/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PNIAPVHPRDRV---STPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTA 81
            |.:..|.|..:.   :||....|  ..::|...::|:.|.|.:.:..       |:|  .:||||
  Fly    85 PELGDVLPNKQTCGQTTPVFRDR--GAENAELNEYPWMVLLLYENRL-------SLI--RYVLTA 138

  Fly    82 AHCTDGAASVTIYYG------ATVRTSPEFTQVVSS-----------SKFRQHESYLAL--TIRN 127
            |||..|.     |..      .:||.....|..::|           .:...|:.:.:.  |.||
  Fly   139 AHCVIGG-----YLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRN 198

  Fly   128 DISLIQTS-SVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIIS 191
            ||:|::.. .|.::..:..|.|   .::....:......|||..|....|.::..::.     .:
  Fly   199 DIALLRLQFPVRYTKKIQPICL---LDAEFPLQDLNLQISGWDPTKSSQTLITSTVKE-----RN 255

  Fly   192 NSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGP---LALDGV-----LIGATSFGSADGCES 248
            .:.|...:.|....|:| |.....|..||.|.||.|   :...||     |.|..|:|......:
  Fly   256 PADCLNRYPSFRSASQV-CAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSA 319

  Fly   249 GAPAAFTRITYYRDWIK 265
            |.|..:|:|.::.:|||
  Fly   320 GIPGVYTKIGHFSEWIK 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 57/252 (23%)
Tryp_SPc 40..267 CDD:238113 59/254 (23%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 59/252 (23%)
Tryp_SPc 108..335 CDD:214473 56/249 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436152
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.