DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG34171

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:217 Identity:55/217 - (25%)
Similarity:88/217 - (40%) Gaps:31/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 WCGGSIIGNEWVLTAAHC-TD------GAASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLALT 124
            :|.|.|:.|..|||:||| ||      ....:.:...|::..:||..:.|..........|....
  Fly    56 FCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPYYHRN 120

  Fly   125 IRNDISLIQTSSVSFSATVNKISL------PAVSNSYSTYEGKTAVASG--WGLTSDQATAVSRD 181
            ..|||::|:..        ..:.|      |.|..:.|...|......|  :|:.. |.......
  Fly   121 QHNDIAIIKLK--------RYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRR-QRFGSFHS 176

  Fly   182 LQYVDLTIISNSKCQETFGSLIV----TSRVLCVDTTNKASTCQGDSGGPLALDGVLIGATSFGS 242
            :..|::.:....:|.:...||:.    ...::||.:|.| ..|..|.||||..||.|.| .:.||
  Fly   177 MLLVNVELRPFDECLKVKKSLMAARPENEDLICVKSTEK-QMCTTDFGGPLFCDGQLYG-IALGS 239

  Fly   243 ADGCESGAPAAFTRITYYRDWI 264
            .: |.|..|..|:.:::|..|:
  Fly   240 IN-CSSPDPVFFSDVSFYNSWV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 54/215 (25%)
Tryp_SPc 40..267 CDD:238113 55/217 (25%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 54/215 (25%)
Tryp_SPc 38..263 CDD:304450 55/217 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471215
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.