DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:284 Identity:86/284 - (30%)
Similarity:126/284 - (44%) Gaps:56/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VHPRDRVS--------TPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSW--WCGGSIIGNEWVL 79
            ::.||.:|        .|::..||..|.:|..|.:|:.|.|.     |.:  :||||:|.|:|||
Zfish    13 MYVRDSLSNLQVCGRPNPTLNPRIVGGVNATHGAWPWMVSLQ-----GRYGHFCGGSLINNQWVL 72

  Fly    80 TAAHC--TDGAASVTIYYG------ATVRT-SPEFTQVVSSSKFRQHESYLALTIRNDISLIQ-T 134
            |||||  ....:|:.:|.|      |.|.: |.....::      .|.||..:|..|||:|:| |
Zfish    73 TAAHCIVDQTPSSIIVYLGKWRSYVADVNSISRTIRHII------PHPSYSNITKDNDIALLQLT 131

  Fly   135 SSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRD-------------LQYVD 186
            |:|.::..:..|.|...::::.  .|..:..:|||......|...|.             ||..:
Zfish   132 STVQYTDYIKPICLADENSNFP--RGTNSWVAGWGDIGVLGTGGIRGRTTVSVPLPHPGILQEAE 194

  Fly   187 LTIISNSKCQETFGSLIVTSRVLCVDTT--NKASTCQGDSGGPLALD---GVLIGATSFGSADGC 246
            |.:.||:.|.......| |..::|..|.  .|| |..|||||||...   .|..|..|.|.  ||
Zfish   195 LKVYSNADCNNICHGRI-TPNMICAGTRPGGKA-TFSGDSGGPLMTKCSVWVQAGVLSHGY--GC 255

  Fly   247 -ESGAPAAFTRITYYRDWIKETSG 269
             :...|..|.|::.|:.||....|
Zfish   256 AQPNLPEVFIRVSEYKQWITGNVG 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 79/255 (31%)
Tryp_SPc 40..267 CDD:238113 80/257 (31%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 78/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.