DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and zgc:112285

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001020685.1 Gene:zgc:112285 / 561476 ZFINID:ZDB-GENE-050913-132 Length:316 Species:Danio rerio


Alignment Length:312 Identity:85/312 - (27%)
Similarity:125/312 - (40%) Gaps:59/312 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVVLVLALASASAGLLPNIAPVH-----------------PRD---RVSTPSITGRITNGKDAVA 48
            |.:|:|.|     ||:.:.|..|                 |:|   ....|:...||.:|.:|..
Zfish     8 FALLLLLL-----GLVLDRASTHAFNPSRLQQHKILHLDWPKDCGLAHFKPNTVERIVSGNEARP 67

  Fly    49 GQFPYQVGLSFSSSAGSWW---CGGSIIGNEWVLTAAHC-----TDGAASVTIYYG----ATVRT 101
            ..:|:||.|.........:   |||::|...||||||||     .:.|:|..|..|    ....|
Zfish    68 HSWPWQVSLQVRPRGSKHYVHVCGGTLIHKNWVLTAAHCFQKGKAEDASSWRIVLGKHQLKRSET 132

  Fly   102 SPEFTQVVSSSKFRQHESY---LALTIRNDISLIQTSS-VSFSATVNKISLPAVSNSYSTYEGKT 162
            :..|..|   .:..:||.:   ....:..||:|::.:: :..|..:....||  ....:...|..
Zfish   133 AERFFPV---KRIYRHEHFRYPAHSELDYDIALVKAATDIQPSNFIRYACLP--RKQINLNPGHY 192

  Fly   163 AVASGWGLT--SDQATAVSRDLQYVDLTIISNSKC-QETFGSLIVTSRVLCV---DTTNKASTCQ 221
            ...:|||.|  ..:..:::..|....|.||....| |:.|....|...::|.   ||....:.||
Zfish   193 CWVTGWGDTRGGKENVSLAEALNQARLPIIDYKTCRQKKFWGDRVRDSMICAGFRDTEGTPAACQ 257

  Fly   222 GDSGGPLALD-----GVLIGATSFGSADGCE-SGAPAAFTRITYYRDWIKET 267
            |||||||...     ..:.|..|||.. ||. ...|:.|||...|..||:.|
Zfish   258 GDSGGPLLCQVGRDRWEVHGIVSFGPI-GCTVENKPSVFTRTAAYIPWIEAT 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 71/252 (28%)
Tryp_SPc 40..267 CDD:238113 72/254 (28%)
zgc:112285NP_001020685.1 Tryp_SPc 58..305 CDD:214473 71/252 (28%)
Tryp_SPc 59..308 CDD:238113 72/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.