DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and zgc:154142

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001092710.1 Gene:zgc:154142 / 555481 ZFINID:ZDB-GENE-070615-2 Length:1090 Species:Danio rerio


Alignment Length:312 Identity:86/312 - (27%)
Similarity:129/312 - (41%) Gaps:80/312 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PNIAPVHPRDRVS------------TPSITGRITNGKDAVAGQFPYQVGLSFSSSAG----SWWC 68
            |.::| :|.|.::            .|::..||.||:.|....:|:||.:.....:.    ...|
Zfish   556 PPVSP-NPWDDITIDWPERCGKPTFPPAVNTRIVNGEPANPHSWPWQVSMQVLRDSEPPMLGHTC 619

  Fly    69 GGSIIGNEWVLTAAHCTDGAASVTIYY--------------GATVRTSPEFTQVVSSSKFRQHES 119
            ||::|...||||||||       .|.|              ..||..|.|  |..:.....:||.
Zfish   620 GGTLIHKNWVLTAAHC-------FIRYADELHRWKMCLGKHNLTVSESTE--QCFNVLGIYRHEG 675

  Fly   120 Y---LALTIRNDISLIQ-TSSVSFSATVNKISLPAVSNSYSTYE-----GKTAVASGWGLTSDQA 175
            :   ...|:..||:|:: ...|:.:..::...||       ::|     ||...|:|||..:..:
Zfish   676 FQYPTVPTVEFDIALVRLDGEVTATEHIDFACLP-------SFEELLPGGKKCYATGWGDETGNS 733

  Fly   176 TA--VSRDLQYVDLTIISNSKCQ--ETFGSLIVTSRVLCVDTT--NKASTCQGDSGGPLALDG-- 232
            ||  |:..|..|.|.::....|:  :.:...:.||.:.|..|:  ...|.|||||||||....  
Zfish   734 TAPKVAETLNQVALPVVPYETCKRMDYWWFQVKTSMICCGYTSPDELKSVCQGDSGGPLVCQDSP 798

  Fly   233 ----VLIGATSFGSADGCE-SGAPAAFTRITYYRDWIKE----------TSG 269
                .:.|.||||.. ||. ...|:.|||.:.|..||:.          |||
Zfish   799 SAPWEVHGITSFGPI-GCVFDKKPSVFTRSSVYLPWIENVIRKDIYDFTTSG 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 76/264 (29%)
Tryp_SPc 40..267 CDD:238113 77/276 (28%)
zgc:154142NP_001092710.1 CUB 57..159 CDD:238001
CUB 172..280 CDD:238001
CUB 310..420 CDD:238001
CUB 432..546 CDD:238001
Tryp_SPc 586..834 CDD:214473 76/264 (29%)
Tryp_SPc 587..837 CDD:238113 77/266 (29%)
CUB 850..959 CDD:238001 86/312 (28%)
CUB 971..1080 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.