DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and ela3l

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_021331840.1 Gene:ela3l / 554107 ZFINID:ZDB-GENE-060710-2 Length:270 Species:Danio rerio


Alignment Length:278 Identity:86/278 - (30%)
Similarity:133/278 - (47%) Gaps:39/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVLA---LASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSW-W 67
            |:||   :|||.....|.|.|           :..|:.||::|....:|:||.|.:.|.:..: .
Zfish     4 LILASVLIASAFGCGKPPIEP-----------LMSRVVNGEEARPHSWPWQVSLQYQSGSSFYHT 57

  Fly    68 CGGSIIGNEWVLTAAHCTDGAASVTIYYGA-TVRTSPEFTQVVSSSKFRQHESY--LALTIRNDI 129
            ||||||...||:|||||.....:..:..|. .:..:.|.:|.:|:.|...||.:  :.:.:.|||
Zfish    58 CGGSIIAENWVMTAAHCISSGRNYRVLVGKHDLSVNEEGSQTISAQKIIVHEKWNSMFVALGNDI 122

  Fly   130 SLIQTSS-VSFSATVNKISLPA----VSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTI 189
            :||:.:. |:.|.|:....:||    :.|:|..|      .||||..|.......| ||...:..
Zfish   123 ALIKLAEPVTLSDTIQLGCVPAPGDVLPNNYPCY------ISGWGRLSTGGALPDR-LQQALMPA 180

  Fly   190 ISNSKCQ--ETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLAL---DGV--LIGATSFGSADGCE 247
            :.::.|.  :.:|| .|...::|.......:.|.|||||||..   ||:  :.|..||.|..||.
Zfish   181 VDHATCSRFDWWGS-SVKETMVCAGGDGVVAGCNGDSGGPLNCKNSDGIWEVHGIASFVSGLGCN 244

  Fly   248 S-GAPAAFTRITYYRDWI 264
            : ..|..|||::.:.||:
Zfish   245 TIRKPTVFTRVSSFTDWV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 76/241 (32%)
Tryp_SPc 40..267 CDD:238113 76/242 (31%)
ela3lXP_021331840.1 Tryp_SPc 29..265 CDD:238113 76/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.