DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and cela1.1

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001020645.2 Gene:cela1.1 / 553249 ZFINID:ZDB-GENE-050522-187 Length:282 Species:Danio rerio


Alignment Length:276 Identity:82/276 - (29%)
Similarity:135/276 - (48%) Gaps:34/276 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSW--WC 68
            :|:|::.:|       |....|| .:...:|..|:..|:.|....:|:|:.|.: .|.|.:  :|
Zfish     4 ILLLSVLAA-------IGLTEPR-YLEDLAIEERVIGGEIAKPHSWPWQISLQY-QSGGRYHHYC 59

  Fly    69 GGSIIGNEWVLTAAHCTDGAASVTIYYG---ATVRTSPEFTQVVSSSKFRQHESYLALTIR--ND 128
            ||::|...||:.||||.|.:...::..|   .|....||  |.:|......|.::....:.  ||
Zfish    60 GGTLIRPGWVMVAAHCVDTSRIWSVALGDHDTTTHEGPE--QYISVKGVFIHPNWNPNIVANGND 122

  Fly   129 ISLIQTS-SVSFSATVNKISLPAVSNSYSTY--EGKTAVASGWGLTSDQATAVSRDLQYVDLTII 190
            |:|:|.| :.:.|:.|...:||    ||...  .|.|...:|||.| ....::|..|:...:.::
Zfish   123 IALLQLSINATLSSYVQVATLP----SYGEILPYGHTCYITGWGRT-QTGGSLSAQLKQAYMPVV 182

  Fly   191 SNSKCQET--FGSLIVTSRVLCVDTTNKASTCQGDSGGPL--ALDG--VLIGATSFGSADGCES- 248
            .:..|.::  :|| .|..|::|...|...|.|.||||.||  ..:|  |:.|.|||.::.||.: 
Zfish   183 DHETCSQSDWWGS-TVKDRMICAGGTTSMSACHGDSGSPLNCLFNGEYVVHGVTSFVASSGCNTY 246

  Fly   249 GAPAAFTRITYYRDWI 264
            ..|..|||::|:..|:
Zfish   247 KKPTVFTRVSYHVSWL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 74/241 (31%)
Tryp_SPc 40..267 CDD:238113 74/242 (31%)
cela1.1NP_001020645.2 Tryp_SPc 29..261 CDD:214473 74/240 (31%)
Tryp_SPc 30..265 CDD:238113 74/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.