DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and ctrb.3

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:287 Identity:97/287 - (33%)
Similarity:146/287 - (50%) Gaps:53/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFVVLVLALASASAGL-LPNIAPVHPRDRVSTPSITG--RITNGKDAVAGQFPYQVGLSFSSSAG 64
            ::::..:|..||:.|. :|.|.||          ::|  ||.||::||...:|:||  |.....|
Zfish     4 LWLLSCVAFFSAAYGCGVPAIPPV----------VSGYARIVNGEEAVPHSWPWQV--SLQDFTG 56

  Fly    65 SWWCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTS---------------PEFTQVVSSSKF 114
            ..:||||:|...||:|||||             :||||               .|..|.:..||.
Zfish    57 FHFCGGSLINEFWVVTAAHC-------------SVRTSHRVILGEHNKGKSNTQEDIQTMKVSKV 108

  Fly   115 RQHESYLALTIRNDISLIQ-TSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAV 178
            ..|..|.:.||.|||:|:: |:..|.:|.|:.:.|...|:::::  |.|.|.||||:|...|...
Zfish   109 FTHPQYNSNTIENDIALVKLTAPASLNAHVSPVCLAEASDNFAS--GMTCVTSGWGVTRYNALFT 171

  Fly   179 SRDLQYVDLTIISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLAL--DGV--LIGATS 239
            ..:||.|.|.::||..|:..:||.| ...::|..... ||:|.|||||||..  |.:  |:|..|
Zfish   172 PDELQQVALPLLSNEDCKNHWGSNI-RDTMICAGAAG-ASSCMGDSGGPLVCQKDNIWTLVGIVS 234

  Fly   240 FGSADGCESGAPAAFTRITYYRDWIKE 266
            :||: .|:...|..:.|:|..|||:.:
Zfish   235 WGSS-RCDPTMPGVYGRVTELRDWVDQ 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 87/244 (36%)
Tryp_SPc 40..267 CDD:238113 87/247 (35%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 87/244 (36%)
Tryp_SPc 34..261 CDD:238113 87/247 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.