DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Tpsab1

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:291 Identity:86/291 - (29%)
Similarity:135/291 - (46%) Gaps:53/291 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFVVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGS 65
            |...::|.|.|.|:.....|::|  .||:         .|..|::|...::|:||.|..:.:...
  Rat    38 MLKLLLLTLPLLSSLVHAAPSLA--MPRE---------GIVGGQEASGNKWPWQVSLRVNDTYWM 91

  Fly    66 WWCGGSIIGNEWVLTAAHCTDGAASVT------------IYYGATVRTSPEFTQVVSSSKFRQHE 118
            .:||||:|..:||||||||. |.....            :||...:.|   .:|::|...|    
  Rat    92 HFCGGSLIHPQWVLTAAHCV-GPNKADPNKLRVQLRKQYLYYHDHLLT---VSQIISHPDF---- 148

  Fly   119 SYLALTIRNDISLIQ-TSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWG-LTSDQATAVSRD 181
             |:|.. ..||:|:: |:.|:.::.|:.:|||..|.::.:  |.....:||| :.:|.:......
  Rat   149 -YIAQD-GADIALLKLTNPVNITSNVHTVSLPPASETFPS--GTLCWVTGWGNINNDVSLPPPFP 209

  Fly   182 LQYVDLTIISNSKCQETF--------GSLIVTSRVLCVDTTNKASTCQGDSGGPLAL----DGVL 234
            |:.|.:.|:.|..|...:        ...||...:||.......| |||||||||..    ..:.
  Rat   210 LEEVQVPIVENRLCDLKYHKGLNTGDNVHIVRDDMLCAGNEGHDS-CQGDSGGPLVCKVEDTWLQ 273

  Fly   235 IGATSFGSADGC-ESGAPAAFTRITYYRDWI 264
            .|..|:|  :|| :...|..:||:|||.|||
  Rat   274 AGVVSWG--EGCAQPNRPGIYTRVTYYLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 75/251 (30%)
Tryp_SPc 40..267 CDD:238113 77/252 (31%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 75/250 (30%)
Tryp_SPc 66..302 CDD:238113 75/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.