DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and ctrb2

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001011477.1 Gene:ctrb2 / 496968 XenbaseID:XB-GENE-1002990 Length:263 Species:Xenopus tropicalis


Alignment Length:273 Identity:93/273 - (34%)
Similarity:150/273 - (54%) Gaps:27/273 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFVVLVLALASASAGL-LPNIAPVHPRDRVSTPSITG--RITNGKDAVAGQFPYQVGLSFSSSAG 64
            :|::..:.|..::.|. :|.|.|:          |:|  ||.||::||:|.:|:||  |.....|
 Frog     4 LFLLSCIVLIGSTYGCGVPAIKPI----------ISGYARIVNGENAVSGSWPWQV--SLQDRTG 56

  Fly    65 SWWCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVR-TSPEFTQVVSSSKFRQHESYLALTIRND 128
            ..:||||::.|.||:||||| ....|..:..|...| :|.|..|.:|.|:..:|.:|...|:.||
 Frog    57 FHFCGGSLVNNLWVVTAAHC-GVTTSHRVILGEYDRSSSAEPIQTMSISRVFKHPNYNTNTMIND 120

  Fly   129 ISLIQTSS-VSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISN 192
            |:|::.|| .||::.|..:.:|..|..:::.|  ..:.:|||.....:......||.|.|.::||
 Frog   121 ITLLKLSSTASFNSRVAPVCIPTSSEVFNSPE--RCITTGWGYVDAYSKLSPNKLQQVTLPLLSN 183

  Fly   193 SKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPL--ALDG--VLIGATSFGSADGCESGAPAA 253
            ::||..:|:.| .|.::|...:. ||:|.|||||||  |.:|  ||.|..|:||:. |...:|..
 Frog   184 TECQRYWGNKI-HSTMICAGASG-ASSCMGDSGGPLVCARNGAWVLAGIVSWGSST-CSPSSPGV 245

  Fly   254 FTRITYYRDWIKE 266
            :.|::..|.|:.:
 Frog   246 YARVSTLRSWMDQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 84/230 (37%)
Tryp_SPc 40..267 CDD:238113 84/233 (36%)
ctrb2NP_001011477.1 Tryp_SPc 34..259 CDD:238113 84/233 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.