DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and prss27

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_031749235.1 Gene:prss27 / 496619 XenbaseID:XB-GENE-5744470 Length:724 Species:Xenopus tropicalis


Alignment Length:280 Identity:92/280 - (32%)
Similarity:141/280 - (50%) Gaps:30/280 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWCG 69
            |.|:.||...:.||| .|.|  .......|.::.||..|:.|..||:|:||  ||.::.|. :||
 Frog     2 VPLLQALLLLTPGLL-GITP--GATDCGIPLVSSRIMGGQSAQEGQWPWQV--SFRNNGGH-FCG 60

  Fly    70 GSIIGNEWVLTAAHC---TDGAASVTIYYGATVRTSPEFTQV-VSSSKFRQHESYLALTIRNDIS 130
            |::|..::|::||||   :..|:|||...||.:...|:..|| :.......:.||:......|||
 Frog    61 GTLISKQYVISAAHCFPSSSSASSVTAVLGAYMIDQPDGNQVAIPVQSATNYPSYVNEGDSGDIS 125

  Fly   131 LIQTSS-VSFSATVNKISLPAVSNSYSTYEGKTAVASGWG-LTSDQATAVSRDLQYVDLTIISNS 193
            |:|.:| |:|:..:..:.|||.:.::.|  |.....:||| :.||.:......||.|.:.:|..:
 Frog   126 LVQLASPVTFTNYILPVCLPADTVTFPT--GLQCWVTGWGNIASDVSLVSPMTLQEVAVPLIDAN 188

  Fly   194 KCQETF--------GSLIVTSRVLCVDTTNKA-STCQGDSGGPLALDG----VLIGATSFGSADG 245
            :|...:        .|:.|.|.::|....|.. .:|||||||||....    .|.|..|||  :|
 Frog   189 ECNALYQTPNSYGTSSISVHSDMICAGFINGGKDSCQGDSGGPLVCSSSGQWFLAGVVSFG--EG 251

  Fly   246 C-ESGAPAAFTRITYYRDWI 264
            | ::..|..:|.:..|.|||
 Frog   252 CGQAYRPGVYTLMPSYTDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 80/244 (33%)
Tryp_SPc 40..267 CDD:238113 81/245 (33%)
prss27XP_031749235.1 Tryp_SPc 34..271 CDD:238113 79/243 (33%)
Tryp_SPc 420..659 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.