DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and cela1.3

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_021324991.1 Gene:cela1.3 / 445032 ZFINID:ZDB-GENE-040801-12 Length:283 Species:Danio rerio


Alignment Length:287 Identity:83/287 - (28%)
Similarity:139/287 - (48%) Gaps:38/287 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFVVLVLA-LASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAG 64
            :::.::.||| |..|....|.:|            .|.||:..|:.|....:|:|:.|.:.|.:.
Zfish    17 LRILLLSVLATLVLAEPRYLEDI------------DIEGRVVGGEVAKPNSWPWQISLQYLSGSS 69

  Fly    65 SW-WCGGSIIGNEWVLTAAHCTDGAASVTIYYG-ATVRTSPEFTQVVSSSKFRQHESYLALTIRN 127
            .: .||||:|...||:|||||.|...:..:..| ..:.......|.:|.|:...|.::.:.::.:
Zfish    70 YYHTCGGSLIRPGWVMTAAHCVDSPRTWRVVLGDHDIYNHEGREQYISVSRAHIHPNWNSNSLSS 134

  Fly   128 --DISLIQTSS-VSFSATVNKISLP----AVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYV 185
              ||:|::.|| .|.::.|...:||    .:.|:...|      .||||.| ....::|.:|:..
Zfish   135 GYDIALLELSSDASLNSYVQLAALPPSGQVLPNNNPCY------ISGWGRT-QTGGSLSAELKQA 192

  Fly   186 DLTIISNSKCQET--FGSLIVTSRVLCVDTTNKASTCQGDSGGPL--ALDG--VLIGATSFGSAD 244
            .|.::.:..|..:  :||.:..:.:...|.|  .:.|.|||||||  .:.|  |:.|.|||.|:.
Zfish   193 YLPVVDHDTCSRSDWWGSTVKNTMICGGDGT--LAGCHGDSGGPLNCQVSGQYVVHGVTSFVSSA 255

  Fly   245 GCESG-APAAFTRITYYRDWIKETSGI 270
            ||.:. .|..|:|::.|..||.:.|.|
Zfish   256 GCNTNKRPTVFSRVSAYISWINDVSTI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 70/240 (29%)
Tryp_SPc 40..267 CDD:238113 71/242 (29%)
cela1.3XP_021324991.1 Tryp_SPc 45..279 CDD:238113 71/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.