DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG9737

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:274 Identity:77/274 - (28%)
Similarity:113/274 - (41%) Gaps:58/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAHCTDGAASVTIYYGA--- 97
            :|.||..|:.|...:||:...|.::|:  .:.|.|::|.:..:||||||..| ..|....|.   
  Fly   146 VTNRIYGGEIAELDEFPWLALLVYNSN--DYGCSGALIDDRHILTAAHCVQG-EGVRDRQGLKHV 207

  Fly    98 -----TVRTSPEFTQV------------VSSSKFRQHESYLALT--IRNDISLIQTS-SVSFSAT 142
                 .|:|.|:..:.            ::..|...|..|...:  ..|||::|:.. .|||:..
  Fly   208 RLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHF 272

  Fly   143 VNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDL--QY-----------VDLTIISNSK 194
            |..|.||..|...:..||:....||||.|         ||  :|           :.:..:||..
  Fly   273 VMPICLPNKSEPLTLAEGQMFSVSGWGRT---------DLFNKYFINIHSPIKLKLRIPYVSNEN 328

  Fly   195 CQ---ETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLAL------DGVLIGATSFGSADGCESGA 250
            |.   |.|| :.:..:.:|........||.|||||||..      ..|..|..|:|......:|.
  Fly   329 CTKILEGFG-VRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGK 392

  Fly   251 PAAFTRITYYRDWI 264
            ||.:|.:..|.|||
  Fly   393 PAVYTNVAEYTDWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 74/269 (28%)
Tryp_SPc 40..267 CDD:238113 75/270 (28%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 74/269 (28%)
Tryp_SPc 150..409 CDD:238113 75/270 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.