DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:273 Identity:127/273 - (46%)
Similarity:169/273 - (61%) Gaps:6/273 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFVVLVLALASASAGLLPNIAPVHPRD-RVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAG 64
            |:...:|.||.....:.|....:.||||| .:....|.||||||..|..||.||.||:|.:|:..
  Fly     1 MRGLTLLSLAFLGVCSALTVPHSLVHPRDLEIRHGGIEGRITNGNLASEGQVPYIVGVSLNSNGN 65

  Fly    65 SWWCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLALTIRNDI 129
            .|||||||||:.|||||||||.||...::||||.....|.|...|||..|.::..|:.|.  :|:
  Fly    66 WWWCGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNEPAFRHTVSSENFIRYPHYVGLD--HDL 128

  Fly   130 SLIQTSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSK 194
            :||:|..|.|.:.||||.||::.:.|::||.....|:|||...|.:..| .||:.|||.:||.::
  Fly   129 ALIKTPHVDFYSLVNKIELPSLDDRYNSYENNWVQAAGWGAIYDGSNVV-EDLRVVDLKVISVAE 192

  Fly   195 CQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLAL-DG-VLIGATSFGSADGCESGAPAAFTRI 257
            ||..:|:...:...:||:|.:..:||||||||||.. :| .|||.|||.||.||:.|.||.|||:
  Fly   193 CQAYYGTDTASENTICVETPDGKATCQGDSGGPLVTKEGDKLIGITSFVSAYGCQVGGPAGFTRV 257

  Fly   258 TYYRDWIKETSGI 270
            |.|.:||||.:||
  Fly   258 TKYLEWIKEETGI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 109/226 (48%)
Tryp_SPc 40..267 CDD:238113 111/228 (49%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 109/226 (48%)
Tryp_SPc 41..266 CDD:238113 110/227 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470857
Domainoid 1 1.000 182 1.000 Domainoid score I7153
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 192 1.000 Inparanoid score I6301
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1010.000

Return to query results.
Submit another query.