DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG11843

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:289 Identity:85/289 - (29%)
Similarity:117/289 - (40%) Gaps:62/289 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLS---FSSSAGSWWCGGSIIGNEWVL 79
            |||. |.:..|...:..|.|..|..|..|...:||:...|.   ..||...|:|||.:|...:||
  Fly    47 LLPG-ASIESRIIDNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVL 110

  Fly    80 TAAHCTD---GAASVTIYYGATVRTSP-EFTQVVSSSKFRQ--------HESYLALTIRNDISLI 132
            |||||.:   |..:|       ||... :|..:...:..|.        |..|......:||.|:
  Fly   111 TAAHCLESERGEVNV-------VRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLV 168

  Fly   133 Q-TSSVSFSATVNKISLP----AVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISN 192
            : |.:|.|....:...||    ..|:|:        :|.|||.|. .|...|..|..|.|....|
  Fly   169 KLTEAVVFDLYKHPACLPFQDERSSDSF--------IAVGWGSTG-LALKPSAQLLKVKLQRYGN 224

  Fly   193 SKCQETFGSLIVTSRV------------LCVDTTNKASTCQGDSGGPLALDG-------VLIGAT 238
            ..|::     ::|.:|            |||.:.....||.|||||||.:..       |::|.|
  Fly   225 WVCKK-----LLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGIT 284

  Fly   239 SFGSADGCESGAPAAFTRITYYRDWIKET 267
            |.|.:.| ..|.|..:||:..|..||..|
  Fly   285 SAGLSCG-SPGIPGIYTRVYPYLGWIART 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 75/263 (29%)
Tryp_SPc 40..267 CDD:238113 77/265 (29%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 77/265 (29%)
Tryp_SPc 68..309 CDD:214473 75/262 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437148
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.