DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG10232

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:268 Identity:71/268 - (26%)
Similarity:108/268 - (40%) Gaps:60/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGKDAVAGQFPYQVGLSFSSSAGSWW---CGGSIIGNEWVLTAAHC--------TD------ 86
            |:..|..|...::|:...|.:.:...|..   |.||:|...:|||||||        ||      
  Fly   256 RMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRV 320

  Fly    87 --GAASVTIYYGATVRTSP--EFT-------QVVSSSKFRQHESYLALT-IRNDISLIQTSS-VS 138
              |...:|        |:|  :||       ..:....|..||.|...: ..:||:|::..: |.
  Fly   321 RLGEHDIT--------TNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRLQTPVR 377

  Fly   139 FSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDL--TIISNS-KCQETFG 200
            ::..:..|.:|  .:....:.....:| |||.|.      :|:...|.|  |:..|. .||:.. 
  Fly   378 YTHEILPICVP--KDPIPLHNHPLQIA-GWGYTK------NREYSQVLLHNTVYENRYYCQDKI- 432

  Fly   201 SLIVTSRVLCVDTTNKASTCQGDSGGPLAL-------DGV-LIGATSFGSADGCESGAPAAFTRI 257
            |.......:|........:|:|||||||.|       |.| |.|..|:|| :.|....|..:|:.
  Fly   433 SFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGS-ENCGDRKPGVYTKT 496

  Fly   258 TYYRDWIK 265
            ..:..|||
  Fly   497 GAFFSWIK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 68/265 (26%)
Tryp_SPc 40..267 CDD:238113 70/267 (26%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 70/264 (27%)
Tryp_SPc 260..503 CDD:214473 67/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436154
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.