DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG16710

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:297 Identity:76/297 - (25%)
Similarity:120/297 - (40%) Gaps:71/297 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PNIAPVHPRDRVSTPSITG-RITNGKDAVAGQFPYQVGLSFSSSAGSWW-------CGGSIIGNE 76
            ||:..:.|..::..|.:.. ||..|::....:.|:...:.::..:.|.|       |.||:|.|.
  Fly    85 PNMGHILPNTQICGPIMPAYRIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNR 149

  Fly    77 WVLTAAHCTD-----------GAASV------TIYYGATVRTSPEFTQVVSSSKFRQHESYLALT 124
            :|||||||..           |..::      ..:.......:||..::......: |..|:...
  Fly   150 YVLTAAHCLRITGLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIK-HRHYMVFE 213

  Fly   125 IR--NDISLIQTS-SVSFSATVNKI--------SLPAVSNSYSTYEGKTAVASGWGLTSD----- 173
            .|  |||:|::.. .|.::|.:..|        |.|:.||.      |..:| ||||:..     
  Fly   214 ERPYNDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSNH------KLQIA-GWGLSHKQGYSN 271

  Fly   174 ---QATAVSRDLQYVDLTIISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLAL----- 230
               ||....|:.....|:..|....:||.         :|........||:|||||||..     
  Fly   272 VLLQAYVNGRNADECSLSEPSLGLDKETH---------ICAGNLGGNDTCKGDSGGPLMAIMERG 327

  Fly   231 DG---VLIGATSFGSADGCESGAPAAFTRITYYRDWI 264
            |.   .|.|.||:|.:. |..| |||:|:.:.:.:||
  Fly   328 DEEFVYLAGITSYGYSQ-CGYG-PAAYTKTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 70/275 (25%)
Tryp_SPc 40..267 CDD:238113 71/276 (26%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 70/275 (25%)
Tryp_SPc 106..362 CDD:238113 69/274 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436155
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.