DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG5255

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:279 Identity:81/279 - (29%)
Similarity:129/279 - (46%) Gaps:48/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFVVLVLALASASAGLLPNIAPVHPRDRVSTPSIT-GRITNGKDAVAGQFPYQVGLSFSSSAGSW 66
            :.:.|||..:||::.:|      :|      |..| .||..|::|.||..|||:.|. ...:|:.
  Fly     4 ILLPLVLFTSSAASQIL------YP------PQYTKNRIVGGEEAAAGLAPYQISLQ-GIGSGAH 55

  Fly    67 WCGGSIIGNEWVLTAAHCTDG--AASVTIYYGATVRTSPEFTQVV--SSSKFR------QHESYL 121
            .|||:||...|::||||||.|  |.:..:..|         ||.:  :.||:.      :|.:|.
  Fly    56 SCGGAIIDERWIITAAHCTRGRQATAFRVLTG---------TQDLHQNGSKYYYPDRIVEHSNYA 111

  Fly   122 ALTIRNDISLIQ-TSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYV 185
            ....||||:|:. ..|:.|......:.|    :..:...|...:.:|||..|......:| ||.:
  Fly   112 PRKYRNDIALLHLNESIVFDNATQPVEL----DHEALVPGSRLLLTGWGTLSLGGDVPAR-LQSL 171

  Fly   186 DLTIISNSKCQETFGSLIVTSRV----LCVDTTNKASTCQGDSGGPLALDGVLIGATSFGSADGC 246
            ::..:...:|:....:   ::||    :|.........|.|||||||..:|.|:...::|..  |
  Fly   172 EVNYVPFEQCRAAHDN---STRVDIGHVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGLP--C 231

  Fly   247 ESGAPAAFTRITYYRDWIK 265
            ..|.|.|...|:||.|:|:
  Fly   232 AKGYPDAHASISYYHDFIR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 71/239 (30%)
Tryp_SPc 40..267 CDD:238113 71/241 (29%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 71/239 (30%)
Tryp_SPc 30..252 CDD:238113 71/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436851
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.