DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG5246

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:289 Identity:91/289 - (31%)
Similarity:126/289 - (43%) Gaps:57/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFVVLVLALASASAGLLPNIAPVHPRDRVS------TPSITGRITNGKDAVAGQFPYQVGLSFSS 61
            :.|:::|:..||.:      ..:|.|.:::      .|..  |:..|.|:..|..||||  |..:
  Fly     7 ISVLVILSQCSAKS------VKIHRRHQLNHHLGHVKPET--RVIGGVDSPTGFAPYQV--SIMN 61

  Fly    62 SAGSWWCGGSIIGNEWVLTAAHCTDGAAS-VTIYYGATVRTSPEFTQVVSSSKFRQHESYLALTI 125
            :.|...||||||..:|:||||||.:.... :.|..|....|.|....:|..||.  |.|:.....
  Fly    62 TFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRPGAEYLVDGSKI--HCSHDKPAY 124

  Fly   126 RNDISLIQTSS--VSFSAT-----VNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQ 183
            .|||:||.|:.  |....|     .:|.|||.|        |.....:|||.|.... ..|..||
  Fly   125 HNDIALIHTAKPIVYDDLTQPIKLASKGSLPKV--------GDKLTLTGWGSTKTWG-RYSTQLQ 180

  Fly   184 YVDLTIISNSKCQETFGSLIVTSRV----------LCVDTTNKASTCQGDSGGPLA-LDGVLIGA 237
            .:||..|.:..||         |||          :|..|.....:|.|||||||. .:..|:|.
  Fly   181 KIDLNYIDHDNCQ---------SRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLVDANQTLVGV 236

  Fly   238 TSFGSADGCESGAPAAFTRITYYRDWIKE 266
            .::|.|  |..|.|..|..:.||.|||::
  Fly   237 VNWGEA--CAIGYPDVFGSVAYYHDWIEQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 82/243 (34%)
Tryp_SPc 40..267 CDD:238113 83/246 (34%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 82/243 (34%)
Tryp_SPc 42..263 CDD:238113 83/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436850
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.