DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG17475

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:234 Identity:74/234 - (31%)
Similarity:103/234 - (44%) Gaps:21/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAHCTDG--AASVTIYYGATVRT 101
            |:.||:|...|:..||:  |.....|...|||.||....|||||||..|  ...:.:..|.....
  Fly    49 RVINGEDVQLGEAKYQI--SLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYE 111

  Fly   102 SPEFTQVVSSSKFRQHESYLALTIRNDISLIQ-TSSVSFSATVNKISLPA--VSNSYSTYEGKTA 163
            .|:....|.....  |.:|.:....|||:||: ..::.|:.......||.  |:|      |...
  Fly   112 KPDAVYFVEEHWI--HCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVAN------GTQL 168

  Fly   164 VASGWGLTSDQATAVSRD-LQYVDLTIISNSKCQETFGSLIVTSRV-LCVDTTNKASTCQGDSGG 226
            :.:|||  |.:....:.| ||...||.:..|.|||...:....... :|..||.....|.|||||
  Fly   169 LLTGWG--STELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGG 231

  Fly   227 PLALDGVLIGATSFGSADGCESGAPAAFTRITYYRDWIK 265
            ||..:|||.|..::|..  |..|.|.:...:.||.:||:
  Fly   232 PLTHNGVLYGLVNWGYP--CALGVPDSHANVYYYLEWIR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 72/231 (31%)
Tryp_SPc 40..267 CDD:238113 73/233 (31%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 72/231 (31%)
Tryp_SPc 50..269 CDD:238113 73/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436852
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.