DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and modSP

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:264 Identity:68/264 - (25%)
Similarity:98/264 - (37%) Gaps:79/264 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PYQVGLSFSSSAGSWW---------CGGSIIGNEWVLTAAHCT--DG-------------AASVT 92
            |:.|||..       |         ||||::..:.|:|||||.  :|             ||...
  Fly   381 PWHVGLYV-------WHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAAKFY 438

  Fly    93 IYYGATV----RTSPEFTQVVSSSKFRQHESY--LA-LTIRNDISL---IQTSSVSFSATVNKIS 147
            ..||.|.    |......::....|.|....|  || ||:.....|   |:...|:|::...|.|
  Fly   439 RNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEPFELSHVIRPICVTFASFAEKES 503

  Fly   148 LPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKCQETFGSLIVTSRVLCVD 212
            :.      ...:||.|   ||.:.:      ..:||:|.....|||.|:.....  :.:...|:.
  Fly   504 VT------DDVQGKFA---GWNIEN------KHELQFVPAVSKSNSVCRRNLRD--IQADKFCIF 551

  Fly   213 TTNKASTCQGDSGGPLA-----------------LDGVLIGATSFGSADGCESGAPAAFTRITYY 260
            |..|:..|||||||...                 |.||:..|.   :||.| :.:....|.|.::
  Fly   552 TQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFLFGVISNAP---NADQC-AHSLTVMTNIQHF 612

  Fly   261 RDWI 264
            .|.|
  Fly   613 EDMI 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 67/262 (26%)
Tryp_SPc 40..267 CDD:238113 68/264 (26%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 67/262 (26%)
Tryp_SPc 371..591 CDD:304450 60/233 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436848
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.