DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG31326

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:262 Identity:72/262 - (27%)
Similarity:114/262 - (43%) Gaps:33/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RDRVSTPSITGRITNGKDAVAGQFPYQVGL--SFSSSAGSWWCGGSIIGNEWVLTAAHCTDG--- 87
            |:|.||   |..|..||....||.|:.|.:  ...|:..::.|||::|....||:||||...   
  Fly   265 RERAST---TPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGR 326

  Fly    88 ---AASVTIYYG---ATVRTSPEFTQVVSSSKFRQHESY-LALTIRNDISLIQTSS-VSFSATVN 144
               |:.:.:..|   ..:.:..||..|   |:...||:: .......|::|::... |.::..:.
  Fly   327 DLPASRLAVSLGRNTLAIHSDGEFRGV---SQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIV 388

  Fly   145 KISLPAVSNSYSTYEGKTAVASGWG--LTSDQATAVSRDLQYVDLTIISNSKCQETFGSLIVTSR 207
            .|.|.:.||.....:|..:..:|||  .|....|.||:   ..||.|:|.:.|......::|...
  Fly   389 PICLWSTSNRMDLPQGLKSYVAGWGPDETGTGNTEVSK---VTDLNIVSEANCALELPHVLVQPS 450

  Fly   208 VLCVDTTNKASTCQGDSGGPL--------ALDGVLIGATSFGSADGCESGAPAAFTRITYYRDWI 264
            .||...|. |..|..|.||||        .|.||:.|.......:.||...|:.||.:..:.:|:
  Fly   451 SLCAKKTG-AGPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWV 514

  Fly   265 KE 266
            ::
  Fly   515 RQ 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 66/247 (27%)
Tryp_SPc 40..267 CDD:238113 67/250 (27%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 66/247 (27%)
Tryp_SPc 277..514 CDD:214473 65/243 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471151
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.