DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG9649

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:310 Identity:72/310 - (23%)
Similarity:118/310 - (38%) Gaps:86/310 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SASAGLLPNIAPV-----HPRDRVSTPSITGR--------ITNGKDAVAGQFPY------QVGLS 58
            ||...:.|:..|.     :|:.......|.||        |.||.:...||.|:      .||..
  Fly   217 SARPSVHPSNTPAQASKFYPQTIGQLSGICGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRD 281

  Fly    59 FSSSAGSWWCGGSIIGNEWVLTAAHC---------------TDGAASVTIY-YGATVRTSPEFTQ 107
            :     ::.|||::|....|::||||               :.|..|:.:: .|||         
  Fly   282 Y-----NFLCGGTLISARTVISAAHCFRFGSRNLPGERTIVSLGRNSLDLFSSGAT--------- 332

  Fly   108 VVSSSKFRQHESYLALTIRN-DISLIQTSS-VSFSATVNKI---------SLPAVSNSYSTYEGK 161
             :..::...||.|......: |::|:|.|: |.....:..|         .||:...||      
  Fly   333 -LGVARLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIKPICLWNENFLLELPSGHKSY------ 390

  Fly   162 TAVASGWGLTSDQATAVSRDLQYVDLTIISNSKCQETFGSL------IVTSRVLCVDTTNKASTC 220
               .:||| ..::....:|..:..|..||:..:|:   |:|      .:||..:|......:..|
  Fly   391 ---VAGWG-EDEKGNRNTRLAKMTDTDIITQWECR---GNLSEENAKFITSHTICASNAQASGPC 448

  Fly   221 QGDSGGPLALD----GVLIGATSFGS--ADGCESGAPAAFTRITYYRDWI 264
            .|||||.|.|.    .:|.|..|.|.  .:.|....|..:|.:..:.:|:
  Fly   449 SGDSGGGLMLQEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 64/277 (23%)
Tryp_SPc 40..267 CDD:238113 64/270 (24%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 63/268 (24%)
Tryp_SPc 259..497 CDD:214473 62/265 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471093
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.