DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and MP1

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:262 Identity:65/262 - (24%)
Similarity:116/262 - (44%) Gaps:38/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGKDAVAGQFPYQVGLSFS--SSAGSWWCGGSIIGNEWVLTAAHCTDGAASVTIYYGATV-- 99
            |:..|.:....:||:...:.::  .:.....||||:|.:.:|||||||.....|.....|..:  
  Fly   137 RVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGVRLGE 201

  Fly   100 ---RTSPEFTQVVSSSKFRQHESYLALTIR----------------NDISLIQ-TSSVSFSATVN 144
               .|:|:.| |..:.:...:|.|:...:.                |||:|:: ...|.:|..:.
  Fly   202 WDASTNPDCT-VGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYSDFIL 265

  Fly   145 KISLPAVSNSYST-YEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKCQETFGS--LIVTS 206
            .:.||.:::.::. :.|:..|.:|||.|....|  |......:|..:..|:|.:.:.:  ..||:
  Fly   266 PVCLPTLASQHNNIFLGRKVVVAGWGRTETNFT--SNIKLKAELDTVPTSECNQRYATQRRTVTT 328

  Fly   207 RVLCVDTTNKASTCQGDSGGPLALDG--------VLIGATSFGSADGCESGAPAAFTRITYYRDW 263
            :.:|........:|:|||||||.|:.        .:.|..|:|.......|.|..:||:..|.:|
  Fly   329 KQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNW 393

  Fly   264 IK 265
            |:
  Fly   394 IE 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 63/259 (24%)
Tryp_SPc 40..267 CDD:238113 64/261 (25%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 63/259 (24%)
Tryp_SPc 138..397 CDD:238113 64/261 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436160
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.