DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and ela2

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001132936.1 Gene:ela2 / 403061 ZFINID:ZDB-GENE-041117-1 Length:266 Species:Danio rerio


Alignment Length:279 Identity:89/279 - (31%)
Similarity:135/279 - (48%) Gaps:31/279 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFVVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGS 65
            ||: |:|.|.:|.|.....|...|           |..|:..|.|.....:|:|..|.:.|.:..
Zfish     1 MKL-VILALFIAGAYGCGQPTYKP-----------IDSRVVGGSDVRPNSWPWQASLQYQSGSSF 53

  Fly    66 W-WCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEF-TQVVSSSKFRQHESYLALTIRND 128
            : .|||::|..:||||||||........:.....:..|.|. :|.:|.::...||::.:..||||
Zfish    54 YHTCGGTLIDKQWVLTAAHCISSRTYRVLLGKHNLPLSSESGSQAISPARIIVHENWDSYNIRND 118

  Fly   129 ISLIQTSS-VSFSATVNKISLPAVSNSYSTYEGKTAVASGWG--LTSDQATAVSRDLQYVDLTII 190
            |:||:.|: |:|:..::...||. |.|...:.....| :|||  .|......:   ||...|.|:
Zfish   119 IALIKLSTPVTFTDKISPACLPD-SGSILPHNSPCYV-TGWGRLWTGGPIADI---LQQALLPIV 178

  Fly   191 SNSKCQET--FGSLIVTSRVLCVDTTNKASTCQGDSGGPL---ALDGV--LIGATSFGSADGCE- 247
            ..:.|.::  :|:| ||..::|.......|:|.|||||||   ..||.  :.|..||||:.||. 
Zfish   179 DQATCTKSDWWGNL-VTDLMVCAGGDGVVSSCNGDSGGPLNCQRRDGTWDVHGIVSFGSSLGCNY 242

  Fly   248 SGAPAAFTRITYYRDWIKE 266
            ...|:.|||::.|..||.:
Zfish   243 PKKPSVFTRVSGYIPWINK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 77/237 (32%)
Tryp_SPc 40..267 CDD:238113 78/240 (33%)
ela2NP_001132936.1 Tryp_SPc 27..259 CDD:214473 77/237 (32%)
Tryp_SPc 28..262 CDD:238113 78/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 1 0.900 - - E33208_3BBU3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.