DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG18223

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:219 Identity:46/219 - (21%)
Similarity:86/219 - (39%) Gaps:37/219 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 WCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLALT------- 124
            :|||.||...::||:|||......:       |..|.....|..::...:....|:|.       
  Fly    78 FCGGVIISRTYILTSAHCAMDKRKI-------VHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIF 135

  Fly   125 IRNDISLIQTSSVSFSATVNK----------ISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVS 179
            :.:..::..|::::......|          |:||.....    .|......|||... :...::
  Fly   136 VPDKFTVFNTNNIALMMLAKKLPLDNPLVGVINLPTADPE----PGLNYTVLGWGRIF-KGGPLA 195

  Fly   180 RDLQYVDLTIISNSKCQETFGSLIVTSRVLCVDTTNKA---STCQGDSGGPLALDGVLIGATSFG 241
            .|:.::|:.::....|::...  |....::|....|..   :.|.||:|.||..:..:.|..|: 
  Fly   196 SDILHIDVELLPRDICEKKVH--IFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNETVFGVVSY- 257

  Fly   242 SADGCESGA-PAAFTRITYYRDWI 264
             ..||.|.. |:.:|.:..:.|||
  Fly   258 -RVGCGSKTLPSIYTNVYMHMDWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 44/217 (20%)
Tryp_SPc 40..267 CDD:238113 46/219 (21%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 46/219 (21%)
Tryp_SPc 60..280 CDD:214473 44/217 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436849
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.