DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG7542

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:274 Identity:115/274 - (41%)
Similarity:162/274 - (59%) Gaps:25/274 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFVVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGS 65
            ||:.|.::|..:..:..||.::.|.              ||||:.|..||||||.||:.|....|
  Fly     2 MKLLVCVLLVGSCTAVPLLTDVEPY--------------ITNGEPAEVGQFPYQAGLNVSFGNWS 52

  Fly    66 WWCGGSIIGNEWVLTAAHCTDGAASVTIYYGA-TVRTSPEFTQ---VVSSSKFRQHESYLALTIR 126
            .||||::|.:.|::|||||.|||.|||:|.|| .:....|..|   :|..|....|.:|:|.|:.
  Fly    53 TWCGGTLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVV 117

  Fly   127 NDISLIQTSS-VSFSATVNKISLP-AVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTI 189
            ||||||:..: |.|:..:...||| .::..:.|||...|.|||||..||.:.:||..|:||::.|
  Fly   118 NDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPI 182

  Fly   190 ISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLAL----DGVLIGATSFGSADGCESGA 250
            :.:|.|: .:.|..|:.:::|:.||:..|||.|||||||..    ...|||:||||::.||:.|.
  Fly   183 MPHSLCR-MYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGF 246

  Fly   251 PAAFTRITYYRDWI 264
            ||.||||:.|.|||
  Fly   247 PAVFTRISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 106/234 (45%)
Tryp_SPc 40..267 CDD:238113 108/235 (46%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 108/235 (46%)
Tryp_SPc 27..260 CDD:214473 106/233 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470919
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1111.010

Return to query results.
Submit another query.