DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Jon74E

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:280 Identity:104/280 - (37%)
Similarity:157/280 - (56%) Gaps:22/280 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFVVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGS 65
            |::..:||..|.......:..:...|        .|.|||..|:.|.|.|||||||||.......
  Fly     1 MQISTILVFLLILVQGRSISCLDMGH--------GIGGRIAGGELARANQFPYQVGLSIEEPNDM 57

  Fly    66 W-WCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSS--KFRQHESYLALTIRN 127
            : |||.|:|.:.::||||||.:.|.::|.|.|..:|.:|.  |::.|:  :...|..:...::.|
  Fly    58 YCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLAPR--QLIRSTNPEVHLHPDWNCQSLEN 120

  Fly   128 DISLIQ-TSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIIS 191
            ||:|:: ........::..|.||.:|:|.::|:...|:|||||..:|::||:|.:|:||...:.|
  Fly   121 DIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVES 185

  Fly   192 NSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLALD------GVLIGATSFGSADGCESGA 250
            |..|:.::.::..|:  :|:|||...|||.|||||||...      .:|||.||:|...||..|.
  Fly   186 NEDCEYSYANIKPTN--ICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGY 248

  Fly   251 PAAFTRITYYRDWIKETSGI 270
            |:.|||||.|.|||.|.||:
  Fly   249 PSVFTRITAYLDWIGEVSGV 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 92/234 (39%)
Tryp_SPc 40..267 CDD:238113 93/236 (39%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 92/234 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1010.080

Return to query results.
Submit another query.