DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG11529

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:250 Identity:91/250 - (36%)
Similarity:132/250 - (52%) Gaps:25/250 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWW-----CGGSIIGNEWVLTAAHCTDGAASVT 92
            ||:.:..:...|.....:|||||.|    .....|     |||:::...|:|||.|||.|.....
  Fly    23 TPTDSYAVGQSKYGRIEKFPYQVML----IGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYD 83

  Fly    93 IYYGATVRTSPEFTQ-----VVSSSKFRQHESYLALTIRNDISLIQ-TSSVSFSATVNKISLPAV 151
            :|.|.   .|.|.|:     |:.|:||..||.:...|..|||:|:: ...|:|:..:...|||: 
  Fly    84 VYLGT---KSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPS- 144

  Fly   152 SNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKCQETFGSLIVTSRVLCVDTTNK 216
            ...:..:.|.:.||||||...:...  |..:||.:|.:|||::|.:.:.  :|||.|:|......
  Fly   145 RYRHDQFAGMSVVASGWGAMVEMTN--SDSMQYTELKVISNAECAQEYD--VVTSGVICAKGLKD 205

  Fly   217 ASTCQGDSGGPLALDG--VLIGATSFGSADGCESGAPAAFTRITYYRDWIKETSG 269
            .:.|.|||||||.|..  :::|.||||.|||||:..|..|||:|:|.|||:...|
  Fly   206 ETVCTGDSGGPLVLKDTQIVVGITSFGPADGCETNIPGGFTRVTHYLDWIESKIG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 86/237 (36%)
Tryp_SPc 40..267 CDD:238113 88/239 (37%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 87/232 (38%)
Tryp_SPc 37..255 CDD:214473 85/229 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
98.970

Return to query results.
Submit another query.