DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG18180

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:283 Identity:105/283 - (37%)
Similarity:150/283 - (53%) Gaps:34/283 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFVVLV---LALASAS-AGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGL---- 57
            ||:|::.:   |||.:|| .||        .|..:.:....|||.||..|..|:.||.|||    
  Fly     1 MKLFLLTLSAALALVAASPTGL--------NRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRT 57

  Fly    58 --SFSSSAGSWWCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSSKFRQHESY 120
              |.|.:.|:    |:||.|:|:||||||..| ..|.|:||:....:..:.|.|....|..|..:
  Fly    58 DGSNSGAVGA----GTIIANDWILTAAHCLTG-DYVEIHYGSNWGWNGAYRQTVRRDNFISHPDW 117

  Fly   121 LALTIRNDISLIQTSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRD-LQY 184
            .:...| ||.||:|..|.|:..:|||.||:::.....|:....||.|||...:...|   | ||.
  Fly   118 PSQGGR-DIGLIRTPHVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDNGNLA---DWLQC 178

  Fly   185 VDLTIISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLAL--DGVLIGATSFGSADGCE 247
            ||:.|||||:|::.:||  |.|..:|....:..|.|.|||||||..  :..|:|..:|.|. .|.
  Fly   179 VDVQIISNSECEQAYGS--VASTDMCTRHADGKSVCGGDSGGPLVTHDNARLVGVITFASV-SCH 240

  Fly   248 SGAPAAFTRITYYRDWIKETSGI 270
            .| |:.:||::.|.:||::.:||
  Fly   241 DG-PSGYTRVSDYLEWIRDQTGI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 89/233 (38%)
Tryp_SPc 40..267 CDD:238113 90/235 (38%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 89/233 (38%)
Tryp_SPc 36..259 CDD:238113 90/235 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470833
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.