DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and sphinx2

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:287 Identity:66/287 - (22%)
Similarity:118/287 - (41%) Gaps:53/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFV-VLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSS-- 62
            ||:.| :|||:|..:          |..::::|.     |||.|..|......|.||:.::.|  
  Fly     1 MKLVVALLVLSLTFS----------VCEKNKLSP-----RITGGYRAKPYTIIYLVGIVYAKSPL 50

  Fly    63 AGSWWCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLALTIRN 127
            :...:..|:||.|:|:||       ...|.|:         ::.:....|| |....|..|.|..
  Fly    51 SSLKFGAGTIISNQWILT-------VKEVLIF---------KYIEAHFGSK-RAFWGYDILRIYR 98

  Fly   128 D-----------ISLIQTSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRD 181
            :           |:|::.....|...::::.:||....:..|.|...:..||| |..:...:...
  Fly    99 ENFYFHYDKTRIIALVKCPYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWG-TDKRKVRLPTW 162

  Fly   182 LQYVDLTIISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLALDG---VLIGATSFGSA 243
            ::.|::.:::|::|.:....|  ....:|.........|:||.||.:...|   ..||.. :...
  Fly   163 MRCVEVEVMNNTECAKYHTPL--KWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPTFIGII-WLMP 224

  Fly   244 DGCESGAPAAFTRITYYRDWIKETSGI 270
            ..|..|.|:...|::.:..|||..||:
  Fly   225 TNCSIGYPSVHIRVSDHIKWIKHVSGV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 52/240 (22%)
Tryp_SPc 40..267 CDD:238113 54/242 (22%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 52/240 (22%)
Tryp_SPc 26..248 CDD:304450 54/242 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470957
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.