DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG10472

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:279 Identity:127/279 - (45%)
Similarity:166/279 - (59%) Gaps:14/279 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVLVLALASASA---GLLPNIAPVHPRDRVSTPSI-TGRITNGKDAVAGQFPYQVGLSFSSSAGS 65
            |:|:..:..|.|   ..:.|:....|..:|...:: :||||.|:.|...||||||||....:.|:
  Fly     8 VLLLATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLLYITGGA 72

  Fly    66 WWCGGSIIGNEWVLTAAHCTDG-AASVTIYYGATVRTS--PEFTQV--VSSSKFRQHESYLALTI 125
            .||||:||.:.|::|||||||. ...|.:|.||..||:  .|..|:  |.:.....||.::|.||
  Fly    73 AWCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIVHEDWIAETI 137

  Fly   126 RNDISLIQTS-SVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTI 189
            .||||||:.. .:.|:..:....||..|:|||||.|:.|:|||||..||.||..:..|||..:.|
  Fly   138 TNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATDILQYATVPI 202

  Fly   190 ISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLALD---GVLIGATSFGSADGCESGAP 251
            ::||.|...:..|:..|.: |:.||...|||.|||||||.||   ..||||||||.|.|||.|.|
  Fly   203 MNNSGCSPWYFGLVAASNI-CIKTTGGISTCNGDSGGPLVLDDGSNTLIGATSFGIALGCEVGWP 266

  Fly   252 AAFTRITYYRDWIKETSGI 270
            ..|||||||.|||:|.||:
  Fly   267 GVFTRITYYLDWIEEKSGV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 114/233 (49%)
Tryp_SPc 40..267 CDD:238113 115/235 (49%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 114/233 (49%)
Tryp_SPc 47..282 CDD:238113 115/235 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470897
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.