DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:272 Identity:172/272 - (63%)
Similarity:211/272 - (77%) Gaps:2/272 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFVVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGS 65
            |||.||..||||:|||||||...|:||||..:..:|.|||||||.|.:|||||||||||:|::||
  Fly     1 MKVLVVFALALATASAGLLPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGS 65

  Fly    66 WWCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLALTIRNDIS 130
            ||||||||.|.|||||||||.||::||||||||||||.:..|.||:..|.||.||.::.:|||||
  Fly    66 WWCGGSIIDNTWVLTAAHCTSGASAVTIYYGATVRTSAQLVQTVSADNFVQHASYNSIVLRNDIS 130

  Fly   131 LIQTSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKC 195
            ||:|.:|:|:|.:||:.|||::.:||||.|:.|:|||||.|||.||:|:..|||....::|.|:|
  Fly   131 LIKTPTVAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQC 195

  Fly   196 QETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLAL--DGVLIGATSFGSADGCESGAPAAFTRIT 258
            |.|:|||:.|:.|:||.|.||.|||.|||||||.|  |..|||.|||.|:.||||||||.|||:|
  Fly   196 QNTYGSLVATNNVICVATPNKVSTCNGDSGGPLVLVSDSKLIGVTSFVSSAGCESGAPAGFTRVT 260

  Fly   259 YYRDWIKETSGI 270
            .|.||||..:|:
  Fly   261 SYLDWIKTNTGV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 145/226 (64%)
Tryp_SPc 40..267 CDD:238113 147/228 (64%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 145/226 (64%)
Tryp_SPc 40..269 CDD:238113 147/228 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470686
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1211.910

Return to query results.
Submit another query.