DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG6462

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:249 Identity:98/249 - (39%)
Similarity:125/249 - (50%) Gaps:12/249 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TPSITGRITNGKDAVAGQFPYQVGLSFS-SSAGSWWCGGSIIGNEWVLTAAHCTDGAASVTIYYG 96
            |.::..||..|:.|..|.|||||||... |.|....||||:|..::|||||||...|.:..||.|
  Fly    70 TAAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTG 134

  Fly    97 AT----VRTSPEFTQVVSSSKFRQHESYLALTIRNDISLIQ-TSSVSFSATVNKISLPAVSNSYS 156
            ||    |..|.|..| |:...|..:..||.....:|::||: ...|..|..|..|.|.......:
  Fly   135 ATVFADVEDSVEELQ-VTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQN 198

  Fly   157 TYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKCQETF-GSLIVTSRVLCVDTTNKASTC 220
            ...||....||||...|.....:|.|||:|..:|...:|...| ..|:...|.||.|.:|....|
  Fly   199 FLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNGRGAC 263

  Fly   221 QGDSGGPLALD----GVLIGATSFGSADGCESGAPAAFTRITYYRDWIKETSGI 270
            .||||||:...    ..|||.||||||:|||.|.|..:||||.|..||::.:.:
  Fly   264 NGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQTAM 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 95/235 (40%)
Tryp_SPc 40..267 CDD:238113 96/237 (41%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 95/235 (40%)
Tryp_SPc 77..314 CDD:238113 96/237 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
65.820

Return to query results.
Submit another query.