DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Prss48

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:292 Identity:91/292 - (31%)
Similarity:144/292 - (49%) Gaps:54/292 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFVVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGS 65
            :||.::|.|.....|.....|:..|..|     |..||||..|:||..|::|:||.|.|..:.. 
Mouse     6 LKVLLLLFLGAFQGSFTKKKNLQSVCGR-----PVHTGRIVGGQDAALGRWPWQVSLRFDYTHS- 64

  Fly    66 WWCGGSIIGNEWVLTAAHC---TDGAASVTIYYGATVR----TSPEF--TQVVSSSKFRQHESYL 121
              ||||:|.:.||||||||   |..:...:::.|:..|    |..|:  :::....|.|..|:  
Mouse    65 --CGGSLISDHWVLTAAHCIKKTWYSFLYSVWLGSIDREYSSTGKEYYVSRIAIPDKHRHTEA-- 125

  Fly   122 ALTIRNDISLIQTSS-VSFSATVNKISLPAVSNSYSTYEGKTAVAS----GWGLTSDQATAVSRD 181
                  ||:|::.|| |:||:.:..|.||.:|...      |..||    |||  .:|.......
Mouse   126 ------DIALLKLSSRVTFSSVILPICLPNISKQL------TVPASCWVTGWG--QNQEGHYPST 176

  Fly   182 LQYVDLTIISNSKCQETFGSL---------IVTSRVLCV-DTTNKASTCQGDSGGPLA--LDGV- 233
            ||.:::.:||:..|::.:..:         ::...:.|. :..::..:|:|||||||:  :||| 
Mouse   177 LQELEVPVISSEACEQLYNPIGVFLPDLERVIKEDMFCAGERQSRKDSCKGDSGGPLSCHIDGVW 241

  Fly   234 -LIGATSFGSADGCESGAPAAFTRITYYRDWI 264
             |:|..|:|..  |....|..:|.:|||:.||
Mouse   242 RLMGVVSWGLE--CGKDLPGVYTNVTYYQKWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 78/252 (31%)
Tryp_SPc 40..267 CDD:238113 79/253 (31%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 78/252 (31%)
Tryp_SPc 40..274 CDD:238113 79/253 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.