DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Ctrc

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001071117.1 Gene:Ctrc / 362653 RGDID:1308379 Length:268 Species:Rattus norvegicus


Alignment Length:281 Identity:87/281 - (30%)
Similarity:125/281 - (44%) Gaps:40/281 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSW--WC 68
            :.|||...|.|....|  |..|      |:::.|:..|:|||...:|:||.|.:... .:|  .|
  Rat     4 ITVLAAILACASCCGN--PAFP------PNLSTRVVGGEDAVPNSWPWQVSLQYLKD-DTWRHTC 59

  Fly    69 GGSIIGNEWVLTAAHCTDGAASVTI---YYGATVRTSPEFTQVVSSSKFRQHESYLALTIRNDIS 130
            |||:|....|||||||.:...:..:   .|..||. ..|.:..........||.:..|.:.|||:
  Rat    60 GGSLITTSHVLTAAHCINKDFTYRVGLGKYNLTVE-DEEGSVYAEVDTIYVHEKWNRLFLWNDIA 123

  Fly   131 LIQTSS-VSFSATVNKISLP----AVSNSYSTYEGKTAVASGWG---LTSDQATAVSRDLQYVDL 187
            :|:.:. |..|.|:....:|    .:...|..|      .:|||   .....|..:.:.||    
  Rat   124 IIKLAEPVELSNTIQVACIPEEGSLLPQDYPCY------VTGWGRLWTNGPIAEVLQQGLQ---- 178

  Fly   188 TIISNSKCQE-TFGSLIVTSRVLCVDTTNKASTCQGDSGGPL---ALDG--VLIGATSFGSADGC 246
            .|:|::.|.. .:..:.|...::|.......|.|.|||||||   |.||  .:.|..||||:.||
  Rat   179 PIVSHATCSRLDWWFIKVRKTMVCAGGDGVISACNGDSGGPLNCQAEDGSWQVHGIVSFGSSSGC 243

  Fly   247 E-SGAPAAFTRITYYRDWIKE 266
            . ...|..|||::.|.|||.|
  Rat   244 NVHKKPVVFTRVSAYNDWINE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 75/244 (31%)
Tryp_SPc 40..267 CDD:238113 77/247 (31%)
CtrcNP_001071117.1 Tryp_SPc 29..262 CDD:214473 75/244 (31%)
Tryp_SPc 30..265 CDD:238113 77/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBU3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.