DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and PRSS41

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:310 Identity:83/310 - (26%)
Similarity:137/310 - (44%) Gaps:58/310 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVLALASASAGL-----------------LPN--------IAPVHPRDRVSTPSITGR------I 40
            |:|||..|.|||                 .|.        :.|...::........|.      :
Human     7 LLLALLLARAGLGKPGELGALQAGPGAARRPGGGGREGHFLCPAESQEEELLSEACGHREIHALV 71

  Fly    41 TNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAHCTDG---AASVTIYYG-ATVRT 101
            ..|.::..|::|:|..|.......   ||||::...|||:||||...   .:..|:..| .|.|.
Human    72 AGGVESARGRWPWQASLRLRRRHR---CGGSLLSRRWVLSAAHCFQKHYYPSEWTVQLGELTSRP 133

  Fly   102 SPEFTQVVSSSKFRQHESYL---AL-TIRNDISLIQ-TSSVSFSATVNKISLPAVSNSYSTYEGK 161
            :| :.....||:::..:..:   || .:||||:|:: .|||:::|.:..|.:.  |::::.....
Human   134 TP-WNLRAYSSRYKVQDIIVNPDALGVLRNDIALLRLASSVTYNAYIQPICIE--SSTFNFVHRP 195

  Fly   162 TAVASGWGLTSDQATAV--SRDLQYVDLTIISNSKC-----QETFGSLIVTSRVLCVDTTNKAST 219
            ....:||||.|...|.:  ..:|:...:||::|::|     |.:..|:|..|............|
Human   196 DCWVTGWGLISPSGTPLPPPYNLREAQVTILNNTRCNYLFEQPSSRSMIWDSMFCAGAEDGSVDT 260

  Fly   220 CQGDSGGPLAL--DGV--LIGATSFGSADGCESGAPAAFTRITYYRDWIK 265
            |:|||||||..  ||:  .:|..|:|...| :...|..:|.|:.|..||:
Human   261 CKGDSGGPLVCDKDGLWYQVGIVSWGMDCG-QPNRPGVYTNISVYFHWIR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 70/250 (28%)
Tryp_SPc 40..267 CDD:238113 72/246 (29%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.