DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and try-9

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:264 Identity:54/264 - (20%)
Similarity:88/264 - (33%) Gaps:81/264 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAH--------- 83
            :.|:|..|  |...||            |..||.:.......|:::....::||||         
 Worm     2 KKRISDGS--GSFRNG------------GNKFSENEFVQHGTGTLVSPWHIVTAAHLIGISEDPL 52

  Fly    84 --CTDG----AASVTIY--YGATVRTS---PEFTQVVSSSKFRQHESYLALTIR----------- 126
              |..|    |..|..|  :.|.|..:   ||..:.:......:..:..:|.||           
 Worm    53 PDCDTGNLREAYFVRDYKNFVAFVNVTCAVPEMCKGLHRKDMFKPLAIKSLYIRKGYVGDGCIDR 117

  Fly   127 ---NDISLIQTSS-VSFSATVNKISLPAV-------SNSYSTYEGKTAVASGWGLTSDQATAVSR 180
               |||::.:... :.||..:....||:.       ...|..:        |:|.....:...|.
 Worm   118 ESFNDIAVFELEEPIEFSKDIFPACLPSAPKIPRIRETGYKLF--------GYGRDPSDSVLESG 174

  Fly   181 DLQYVDLTIISNSKCQETF--GSLIVTSRVLCVDTTNKASTCQGDSGGPLALDG------VLIGA 237
            .|:.:...:   ::|.:.|  |.      |.|....|:..:|.||||..:....      ||:|.
 Worm   175 KLKSLYSFV---AECSDDFPYGG------VYCTSAVNRGLSCDGDSGSGVVRTSDTRNVQVLVGV 230

  Fly   238 TSFG 241
            .|.|
 Worm   231 LSAG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 50/253 (20%)
Tryp_SPc 40..267 CDD:238113 50/252 (20%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 45/222 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.