DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and scaf

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:231 Identity:55/231 - (23%)
Similarity:93/231 - (40%) Gaps:44/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAHCTDGAASVTI-------YYGATVRTS 102
            ||...:.|:| .:....|:.:..|||:|||:::||::|.|.:|.....|       ..|:|....
  Fly   428 DANFAEIPWQ-AMILRESSKTLICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEPL 491

  Fly   103 PEFTQVVSSSKFRQHESYLALTIRNDISLIQTS-SVSFSATVNKISLPAVSNSYSTYEGKTAVAS 166
            |  .|:........|..|...|..:|:::|:.. .:.|::.:..|.:    :.....:.:....|
  Fly   492 P--FQLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICI----SDEDPKDSEQCFTS 550

  Fly   167 GWGLTSDQATAVSRD--LQYVDLTI-ISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPL 228
            |||   .||.::..:  |.:|..|: .:.|:|.....|         |.:..|..:||.|.|..|
  Fly   551 GWG---KQALSIHEEGALMHVTDTLPQARSECSADSSS---------VCSATKFDSCQFDVGSAL 603

  Fly   229 A--------LDGVLIGATSFGSADGCESGAPAAFTR 256
            |        |.|:..|..|      |..|....|.:
  Fly   604 ACGSGSSVRLKGIFAGENS------CGEGQTVRFAK 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 55/231 (24%)
Tryp_SPc 40..267 CDD:238113 55/231 (24%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 49/206 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435399
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.