DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG4650

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:241 Identity:63/241 - (26%)
Similarity:102/241 - (42%) Gaps:25/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GRITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTS 102
            |.:||||.|.....|:...|..|...  :.|||::|..:.||||||||..:..:....|..:.|.
  Fly    29 GLLTNGKIANNISSPWMAYLHTSELL--YVCGGTVITEKLVLTAAHCTRASEQLVARIGEFIGTD 91

  Fly   103 PEFTQVVSSSKFRQ---HESYLALTIRNDISLI-QTSSVSFSATVNKISLPAVSNSYSTYEGKTA 163
            .....::|..:..|   |..|...|..|||::: ..:.:.||.|:..|.: .....:..|.....
  Fly    92 DANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLATDIVFSKTIRPICI-VWWTIWRKYIDNIQ 155

  Fly   164 VASG--WGLTSDQATAVSRDLQYVDLTIISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGG 226
            |.||  |||.:|:..  |...:..|:.....:.|....|:.|::|:....|:.:|  .|..|...
  Fly   156 VLSGAQWGLPNDRNE--SDAFRITDIRRQPANMCSTLNGTAILSSQFCAGDSDSK--LCNVDFSS 216

  Fly   227 PLAL--------DGVLIGATSFGSADGCESGAPAAFTRITYYRDWI 264
            ||..        ..||||..:  :...|:..  :.:|.:..:.|:|
  Fly   217 PLGAIITFKNIQRYVLIGIAT--TNQKCKRA--SVYTDVLSHTDFI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 61/238 (26%)
Tryp_SPc 40..267 CDD:238113 62/239 (26%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 60/235 (26%)
Tryp_SPc 33..258 CDD:304450 60/235 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436166
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.