DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:274 Identity:139/274 - (50%)
Similarity:178/274 - (64%) Gaps:15/274 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFVVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGS 65
            |||||||.||||:.||   ..:..|||:|......|.|||.||..|..|:.||.|||.||.: |.
  Fly     1 MKVFVVLALALAAVSA---ETVQQVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGN-GG 61

  Fly    66 WWCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLALTIRNDIS 130
            ||||||||.::|||||||||:||:.||||||||.||:.:||..|.|..|.|:.::.... .|||:
  Fly    62 WWCGGSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQFTHTVGSGDFIQNHNWPNQN-GNDIA 125

  Fly   131 LIQTSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRD--LQYVDLTIISNS 193
            ||:|..|.|...|||:.||:.::.|:.|:...|||.|||||    ||.|:.  ::.|||.|||||
  Fly   126 LIRTPHVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLT----TAGSQPDWMECVDLQIISNS 186

  Fly   194 KCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLAL--DGVLIGATSFGSADGCESGAPAAFTR 256
            :|..|:|:  ....:|||.|:...|||.|||||||.|  .|.|:|.||:.|.:||.:|.|:.|||
  Fly   187 ECSRTYGT--QPDGILCVSTSGGKSTCSGDSGGPLVLHDGGRLVGVTSWVSGNGCTAGLPSGFTR 249

  Fly   257 ITYYRDWIKETSGI 270
            :|...|||::.||:
  Fly   250 VTNQLDWIRDNSGV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 116/228 (51%)
Tryp_SPc 40..267 CDD:238113 117/230 (51%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 116/228 (51%)
Tryp_SPc 37..260 CDD:238113 117/230 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470824
Domainoid 1 1.000 182 1.000 Domainoid score I7153
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 192 1.000 Inparanoid score I6301
Isobase 1 0.950 - 0 Normalized mean entropy S8278
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - mtm9580
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1211.850

Return to query results.
Submit another query.