DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and prss60.3

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:243 Identity:87/243 - (35%)
Similarity:128/243 - (52%) Gaps:28/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAHCTDGAASVT--IYYGATVRT 101
            ||..|.:|..|.:|:||.| .|...|..:||||:|.:|||||||||..|.:..|  :|.|   |.
Zfish    35 RIVGGVNASPGSWPWQVSL-HSPKYGGHFCGGSLISSEWVLTAAHCLSGVSETTLVVYLG---RR 95

  Fly   102 SPEFTQVVSSS----KFRQHESYLALTIRNDISLIQTSS-VSFSATVNKISLPAVSNSYSTYEGK 161
            :.:...:..:|    |...|.||.:.|..|||:|::.|| |:|:..:..:.|.|.::.||.  |.
Zfish    96 TQQGINIYETSRNVAKSFVHSSYNSNTNDNDIALLRLSSAVTFTNYIRPVCLAAQNSVYSA--GT 158

  Fly   162 TAVASGWGLTSDQATAVSRD----LQYVDLTIISNSKCQETFGSLIVTSRVLCVDTTNKA-STCQ 221
            ::..:|||   |....|:..    ||...:.:::|.:|....||..||:.::|...|... .|||
Zfish   159 SSWITGWG---DIQAGVNLPAPGILQETMIPVVANDRCNALLGSGTVTNNMICAGLTQGGKDTCQ 220

  Fly   222 GDSGGP----LALDGVLIGATSFGSADGC-ESGAPAAFTRITYYRDWI 264
            ||||||    |....|..|.||:|.  || :..:|..:||::.|:.||
Zfish   221 GDSGGPMVTRLCTVWVQAGITSWGY--GCADPNSPGVYTRVSQYQSWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 85/241 (35%)
Tryp_SPc 40..267 CDD:238113 86/242 (36%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 86/242 (36%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.