DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and ela2l

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_956180.1 Gene:ela2l / 334304 ZFINID:ZDB-GENE-040511-1 Length:267 Species:Danio rerio


Alignment Length:281 Identity:92/281 - (32%)
Similarity:136/281 - (48%) Gaps:35/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFVVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGS 65
            ||..|:.||.:.:.|.||     |..|      |.:| |:..|.|.....:|:|:.|.:.|  ||
Zfish     2 MKFVVLAVLVVGAYSCGL-----PTFP------PIVT-RVVGGVDVRPNSWPWQISLQYKS--GS 52

  Fly    66 WW---CGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQV-VSSSKFRQHESYLALTIR 126
            .|   ||||:|..:||||||||...:.:..::.|....:..|...| :.:.|...||::.:.|||
Zfish    53 NWYHTCGGSLIDKQWVLTAAHCISSSRTYRVFLGKHSLSQEENGSVAIGAGKIIVHEAWNSFTIR 117

  Fly   127 NDISLIQ-TSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWG--LTSDQATAVSRDLQYVDLT 188
            |||:||: .::|:...|:....||..  .|..........:|||  .|:.....:   ||...|.
Zfish   118 NDIALIKLETAVTIGDTITPACLPEA--GYVLPHNAPCYVTGWGRLYTNGPLADI---LQQALLP 177

  Fly   189 IISNSKCQET--FGSLIVTSRVLCVDTTNKASTCQGDSGGPL---ALDGV--LIGATSFGSADGC 246
            ::.::.|.::  :||.:.||.| |.......:.|.|||||||   ..||.  :.|..||||...|
Zfish   178 VVDHATCSKSDWWGSQVTTSMV-CAGGDGVVAGCDGDSGGPLNCAGSDGAWEVHGIVSFGSGLSC 241

  Fly   247 E-SGAPAAFTRITYYRDWIKE 266
            . :..|..|||::.|.|||.:
Zfish   242 NYNKKPTVFTRVSAYSDWISK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 78/239 (33%)
Tryp_SPc 40..267 CDD:238113 79/242 (33%)
ela2lNP_956180.1 Tryp_SPc 28..260 CDD:214473 78/239 (33%)
Tryp_SPc 29..263 CDD:238113 79/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.