DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Hayan

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:272 Identity:74/272 - (27%)
Similarity:129/272 - (47%) Gaps:35/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSS-SAGSWWCGGSIIGNEWVLTAAH 83
            |::|... :.|.....:|..|.:|:....|.:|:...::::| .:.::.||||:|.:.:||||||
  Fly   366 PSVAACE-KIRSGGKPLTVHILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAH 429

  Fly    84 C--TDGAASVTIYYGATVRTSPE-FTQVVSSSKFRQHESYLALTIRNDISLIQTSSVSFSATVNK 145
            |  :|.:....:..||....:|| ..|.::....:.|..|...:...||:::|.:.   .|..:.
  Fly   430 CVNSDDSTPSFVRLGALNIENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAE---DAKESD 491

  Fly   146 ISLPAV-----SNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKCQETFGSL--- 202
            :..||.     |:..:.|  |..|| |||:.:....|||:.|....|.::...:|..:|...   
  Fly   492 VIRPACLYTDRSDPPANY--KYFVA-GWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSA 553

  Fly   203 -------IVTSRVLCVDTTNKASTCQGDSGGPLAL-----DGV--LIGATSFGSADGCESGAPAA 253
                   ::.|::...|...:...|||||||||.|     ||.  ::|..|.|.  ||.:..|..
  Fly   554 NRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGF--GCATKTPGL 616

  Fly   254 FTRITYYRDWIK 265
            :||::.:.|:|:
  Fly   617 YTRVSSFLDYIE 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 69/250 (28%)
Tryp_SPc 40..267 CDD:238113 70/252 (28%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 69/250 (28%)
Tryp_SPc 385..630 CDD:238113 70/252 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437026
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.