DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and sphe

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:236 Identity:68/236 - (28%)
Similarity:107/236 - (45%) Gaps:20/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GRITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAHCT--DG----AASVTIYYG 96
            |||..|:||.|....:...|...:   :..|||||:....:||.|||.  ||    |:.:....|
  Fly    24 GRIMGGEDADATATTFTASLRVDN---AHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVG 85

  Fly    97 ATVRTSPEFTQVVSSSKFRQHESYLALTIRNDISLIQTSS-VSFSATVNKISLPAVSNSYSTYEG 160
            :|.:.:.  .::|:......|..|  ..:.|::::|..|| ::::..:..|.|.| |......||
  Fly    86 STNQYAG--GKIVNVESVAVHPDY--YNLNNNLAVITLSSELTYTDRITAIPLVA-SGEALPAEG 145

  Fly   161 KTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSG 225
            ...:.:|||.|||...  |..::.:.|.:...:.|.:.:..  ...:..|:....|..||.||.|
  Fly   146 SEVIVAGWGRTSDGTN--SYKIRQISLKVAPEATCLDAYSD--HDEQSFCLAHELKEGTCHGDGG 206

  Fly   226 GPLALDGVLIGATSFGSADGCESGAPAAFTRITYYRDWIKE 266
            |.......|||.|:| ....|.|..|..|.|::.|.|||:|
  Fly   207 GGAIYGNTLIGLTNF-VVGACGSRYPDVFVRLSSYADWIQE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 64/231 (28%)
Tryp_SPc 40..267 CDD:238113 66/234 (28%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 61/218 (28%)
Tryp_SPc 42..244 CDD:214473 58/214 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471062
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.