DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG31220

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:285 Identity:74/285 - (25%)
Similarity:110/285 - (38%) Gaps:53/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAG---------SWWCGGSIIGNE 76
            |..|.:|  ....|..|.|:..|.:....::|:...|.:.:.:.         |  ||||:|...
  Fly    87 NTLPSYP--DCGKPQTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPS--CGGSLINTR 147

  Fly    77 WVLTAAHC-TDGAASV---------------TIYYGATVRTSPEFTQVVSSSKFRQHESY--LAL 123
            :||||||| ||....:               .|..||.:..:|....:...| ...|..|  ...
  Fly   148 YVLTAAHCVTDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVES-ITSHNDYDPANY 211

  Fly   124 TIRNDISLIQTSS-VSFSATVNKISL---PAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQY 184
            |.||||:|::... |.::.....|.:   |.....:..|      .:|||.|....|. |:.|::
  Fly   212 TFRNDIALVRLKEPVRYTMAYYPICVLDYPRSLMKFKMY------VAGWGKTGMFDTG-SKVLKH 269

  Fly   185 VDLTIISNSKCQETFGSLIVTSRV-LCVDTTNKASTCQGDSGGPL-ALDG-------VLIGATSF 240
            ..:.:....:|.|.:.......|. :|....:...||.||||.|| ...|       .|.|.||:
  Fly   270 AAVKVRKPEECSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLAGITSY 334

  Fly   241 GSADGCESGAPAAFTRITYYRDWIK 265
            |...| ..|.|:.|||...:..||:
  Fly   335 GGPCG-TIGWPSVFTRTAKFYKWIR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 67/264 (25%)
Tryp_SPc 40..267 CDD:238113 68/266 (26%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 67/264 (25%)
Tryp_SPc 104..360 CDD:238113 68/266 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436151
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.