DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG31269

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:292 Identity:83/292 - (28%)
Similarity:122/292 - (41%) Gaps:63/292 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFVVLVLALASASAGLLPNIAPVHPRDRVSTPSITG------RITNGKDAVAGQFPYQVGLSF 59
            |...|:|:|...|.    |.:|..:    |:...|..|      ||..|:.|..|..|||:.|..
  Fly     1 MSAVVLLILLGLSG----LVSITAI----RIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQG 57

  Fly    60 SSSAGSWWCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSSKFRQ-------- 116
            .|.|.|  |||:||...:|||||||.:.|            ..|....|..::|:.|        
  Fly    58 ISGAHS--CGGAIINETFVLTAAHCVENA------------FIPWLVVVTGTNKYNQPGGRYFLK 108

  Fly   117 ----HESYLALTIRNDISLIQ-TSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQAT 176
                |.:|....:.|||:|:: ...:::......|.||.|    ....|...:.:|||.|....|
  Fly   109 AIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLV----PMQPGDEVILTGWGSTVLWGT 169

  Fly   177 AVSRDLQYVDLTIISNSKCQETF--------GSLIVTSRVLCVDTTNKASTCQGDSGGPLALDGV 233
            : ..|||.:.|..:.:.:|:...        |.:...||:       ....|.|||||||..:|.
  Fly   170 S-PIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRL-------GEGACHGDSGGPLVSNGY 226

  Fly   234 LIGATSFGSADGCESGAPAAFTRITYYRDWIK 265
            |:|..::|..  |.:|.|.....:.:|||||:
  Fly   227 LVGLVNWGWP--CATGVPDVHASVYFYRDWIR 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 71/245 (29%)
Tryp_SPc 40..267 CDD:238113 72/247 (29%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 71/245 (29%)
Tryp_SPc 38..258 CDD:238113 72/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.