DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG31205

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:269 Identity:68/269 - (25%)
Similarity:103/269 - (38%) Gaps:27/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LPNIAPVHPRDRVSTPSITGRITNGKD-------AVAGQFPYQVGLSFSSSAGS--WWCGGSIIG 74
            |..|..:||..:.::......|.|.|.       |...:.|:.|.:...:..||  ..|.|.:|.
  Fly    10 LLTITTLHPTIQAASVGQECGIFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGILID 74

  Fly    75 NEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLALTIRNDISLIQ-TSSVS 138
            :..|:|||||.....|.:||  ..|....:.:.:...|....|..|......||:::|: |..|.
  Fly    75 SRRVVTAAHCVSKDESESIY--GVVFGDSDSSNINLVSAVTVHPDYSPRKFENDLAIIELTKEVV 137

  Fly   139 FSATVNKISLPAVSN---SYSTYEGKTAVASGWGLTSDQATAVSRDLQ---YVDLTIISNSKCQE 197
            ||..|..|.||:||.   ...|...|..||...|.:.|:..:.::.|.   .:..|.|.:.:|.|
  Fly   138 FSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLDKRIKMTYTKIDSKECHE 202

  Fly   198 TFGSLIVTSRVLCVDTTN---KASTCQGDSGGPLALDGVLIGATSFGSADGCESGAPAAFTRITY 259
            .....  ...::|..|..   ..|.....||.|.....:.|....|.|:|....|    :..|..
  Fly   203 KQARF--PEELICGHTERSPLSGSALTEASGTPRQFHLLGIAVAGFFSSDLDHQG----YLNIRP 261

  Fly   260 YRDWIKETS 268
            :.|||.:.|
  Fly   262 HLDWISKNS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 61/243 (25%)
Tryp_SPc 40..267 CDD:238113 63/245 (26%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 37/125 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.