DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and sphinx1

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:283 Identity:65/283 - (22%)
Similarity:114/283 - (40%) Gaps:45/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFVVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGL-SFSSSAG 64
            ||:.|.|::...:.|.|....::|              ||..|..|......|.||: .|.|...
  Fly     1 MKLVVTLLVLSLTVSVGEKNKLSP--------------RIAGGYRAKTFTIIYLVGIVYFKSQTS 51

  Fly    65 SWWCG-GSIIGNEWVLTA------AHCTDGAASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLA 122
            |...| |:||.|:|:||.      ::.....||...|.|..:..       :....||.|..   
  Fly    52 SLNYGAGTIISNQWILTVKTVLKYSYIEVHLASRRSYRGFDIIR-------IYKENFRFHYD--- 106

  Fly   123 LTIRND--ISLIQTSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYV 185
                ||  |:|::.....|...::::.:||....:..|.|...:..|:| |..:...:...::.:
  Fly   107 ----NDHVIALVKCPYQKFDRRMDRVRVPAYDTRFERYVGNMTMVCGYG-TEKRHAKLPEWMRCI 166

  Fly   186 DLTIISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLALDG---VLIGATSFGSADGCE 247
            ::.:::|::|.:.:..|  ....:|.........|:||.||.:...|   ..||.. :...:.|.
  Fly   167 EVEVMNNTECAKYYTPL--KWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTFIGII-WLMPENCS 228

  Fly   248 SGAPAAFTRITYYRDWIKETSGI 270
            .|.|:...|::.:..|||..||:
  Fly   229 IGYPSVHIRVSDHIKWIKRVSGV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 53/237 (22%)
Tryp_SPc 40..267 CDD:238113 55/239 (23%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 53/237 (22%)
Tryp_SPc 26..248 CDD:304450 55/239 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470954
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.